Research Brief
Ll 37: Chemical Properties
24 PubMed CitationsExpert ReviewedGMP CertifiedLast Reviewed: July 2026
Chemical Properties
| Molecular Formula | C₂₀₅H₃₄₀N₆₀O₅₃ |
| Molecular Weight | 4493.33 Da |
| CAS Number | Not established |
| PubChem CID | 16198951 |
| Sequence (1-Letter) | [LL-37, 37 aa] |
| Sequence (3-Letter) | Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser |
| Structure | Linear, amphipathic α-helix (in membranes), cysteine-free, curved helix-bend-helix motif (residues 2–31) |
| Net Charge | +6 at physiological pH |
| Gene Origin | CAMP gene, chromosome 3p21.3 — encodes hCAP18 precursor |
| Classification | Cathelicidin Antimicrobial Peptide / Host Defense Peptide |
| Clinical Name | Ropocamptide (Promore Pharma AB) |
Identifiers
| Purity Standard | ≥90–110% content by HPLC (UV at 217 nm) |
| Identity Confirmation | LC-MS molecular mass ~4493.33 Da |
| Counter-Ion | Acetate (synthetic peptide acetate salt via SPPS) |
| Detection Methods | RP-HPLC, LC-MS, amino acid analysis, ELISA, antimicrobial bioassays |
References
- Johansson J, Gudmundsson GH, Rottenberg ME, et al. Conformation-dependent antibacterial activity of the naturally occurring human peptide LL-37. Journal of Biological Chemistry. 1998;273(6):3718-3724.
- Gudmundsson GH, Agerberth B, Odeberg J, et al. The human gene FALL39 and processing of the cathelin precursor to the antibacterial peptide LL-37 in granulocytes. European Journal of Biochemistry. 1996;238(2):325-332.
- Ridyard KE, Overhage J. The Potential of Human Peptide LL-37 as an Antimicrobial and Anti-Biofilm Agent. Antibiotics. 2021;10(6):650.
- Duplantier AJ, van Hoek ML. The Human Cathelicidin Antimicrobial Peptide LL-37 as a Potential Treatment for Polymicrobial Infected Wounds. Frontiers in Immunology. 2013;4:143.
- Grönberg A, Mahlapuu M, Ståhle M, et al. Treatment with LL-37 is Safe and Effective in Enhancing Healing of Hard-to-Heal Venous Leg Ulcers: A Randomized, Placebo-Controlled Clinical Trial. Wound Repair and Regeneration. 2014;22(5):613-621.
- Yang B, Good D, Mosaiab T, et al. Significance of LL-37 on Immunomodulation and Disease Outcome. BioMed Research International. 2020;2020:8349712.
- Heilborn JD, Nilsson MF, Kratz G, et al. The cathelicidin anti-microbial peptide LL-37 is involved in re-epithelialization of human skin wounds and is lacking in chronic ulcer epithelium. Journal of Investigative Dermatology. 2003;120(3):379-389.
- Scott MG, Davidson DJ, Gold MR, et al. The human antimicrobial peptide LL-37 is a multifunctional modulator of innate immune responses. The Journal of Immunology. 2002;169(7):3883-3891.
- Svensson D, Nilsson BO. Human antimicrobial/host defense peptide LL-37 may prevent the spread of a local infection through multiple mechanisms: an update. Inflammation Research. 2025;74(1):36.
- Piktel E, Niemirowicz K, Wnorowska U, et al. The Role of Cathelicidin LL-37 in Cancer Development. Archivum Immunologiae et Therapiae Experimentalis. 2016;64(1):33-46.
- Zhang Z, Chen WQ, Zhang SQ, et al. The human cathelicidin peptide LL-37 inhibits pancreatic cancer growth by suppressing autophagy and reprogramming of the tumor immune microenvironment. Frontiers in Pharmacology. 2022;13:906625.
- Lu F, Zhu Y, Zhang G, Liu Z. Renovation as innovation: Repurposing human antibacterial peptide LL-37 for cancer therapy. Frontiers in Pharmacology. 2022;13:944147.
- Miranda E, Bramono K, Yunir E, et al. Efficacy of LL-37 cream in enhancing healing of diabetic foot ulcer: a randomized double-blind controlled trial. Archives of Dermatological Research. 2023;315(9):2623-2633.
- Seil M, Nagant C, Dehaye JP, et al. Spotlight on Human LL-37, an Immunomodulatory Peptide with Promising Cell-Penetrating Properties. Pharmaceuticals. 2010;3(11):3435-3460.
- Ergün FC, Kars MD, Kars G. Development and Characterization of LL37 Antimicrobial-Peptide-Loaded Chitosan Nanoparticles. Polymers. 2025;17(13):1884.
- Mahlapuu M, Sidorowicz A, Mikosinski J, et al. Evaluation of LL-37 in healing of hard-to-heal venous leg ulcers: A multicentric prospective randomized placebo-controlled clinical trial. Wound Repair and Regeneration. 2021;29(6):938-950.
- Ohuchi K, Ikawa T, Amagai R, et al. LL-37 Might Promote Local Invasion of Melanoma by Activating Melanoma Cells and Tumor-Associated Macrophages. Cancers. 2023;15(6):1678.
- Miura S, Garcet S, Li X, et al. Cathelicidin Antimicrobial Peptide LL37 Induces Toll-Like Receptor 8 and Amplifies IL-36γ and IL-17C in Human Keratinocytes. Journal of Investigative Dermatology. 2023;143(5):832-841.e4.
- Lin X, Wang R, Mai S. Advances in delivery systems for the therapeutic application of LL37. Journal of Drug Delivery Science and Technology. 2020;60(9):102016.
- Wu WK, Wang G, Coffelt SB, et al. Emerging Roles of the Host Defense Peptide LL-37 in Human Cancer and its Potential Therapeutic Applications. International Journal of Cancer. 2010;127(8):1741-1747.
- Alalwani SM, Sierigk J, Herr C, et al. The antimicrobial peptide LL-37 modulates the inflammatory and host defense response of human neutrophils. European Journal of Immunology. 2010;40(4):1118-1126.
- Lozeau LD, Kole D, Dominko T, et al. Activity and toxicity of a recombinant LL37 antimicrobial peptide. Frontiers in Bioengineering and Biotechnology. 2016.
- Wan W, Zhang L, Lin Y, et al. Mitochondria-derived peptide MOTS-c: effects and mechanisms related to stress, metabolism and aging. Journal of Translational Medicine. 2023;21(1):36.
- M.D. Anderson Cancer Center. Induction of Antitumor Response in Melanoma Patients Using the Antimicrobial Peptide LL37. ClinicalTrials.gov Protocol NCT02225366. 2015.
Related Research Questions
FOR RESEARCH USE ONLY
This content is provided for educational and informational purposes only. Products are furnished for in-vitro studies only and are not medicines, drugs, or supplements. Not approved by the FDA to prevent, treat, or cure any condition.
